Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Bathroom Accessories
Freestanding Copper Bathtub with two additional Washbasins
Freestanding Copper Bathtub with two additional Washbasins
Freestanding Marble Stone Bathtub - Handcrafted in Bali
Freestanding Marble Stone Bathtub - Handcrafted in Bali
£1,999.00
Freestanding Terrazzo Stone Bathtub - Handcrafted in Bali
Freestanding Terrazzo Stone Bathtub - Handcrafted in Bali
£1,799.00
Handcrafted Brass Freestanding Luxury Bathtub - Spa Quality
Handcrafted Brass Freestanding Luxury Bathtub - Spa Quality
£3,999.00
Handcrafted Copper Bathtub - Spa Quality
Handcrafted Copper Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
£2,499.00
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Handcrafted Copper Freestanding Bathtub - Spa Quality
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i